PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00034.1.g02820.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 441aa    MW: 47520.2 Da    PI: 8.4863
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00034.1.g02820.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP74.22.2e-2372120250
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                                     C vegC++dls+ +eyhrrhkvCe+hsk+pvv+v+g++qrfCqqCsr+ 
  Zjn_sc00034.1.g02820.1.am.mkhc  72 CSVEGCTVDLSKGREYHRRHKVCEAHSKTPVVVVAGQQQRFCQQCSRYA 120
                                     ***********************************************95 PP

2SBP47.93.5e-151922234778
                                     SSEEETTT--SS--S-STTTT-------S--- CS
                             SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                      rfh l efDe krsCr+rL++hn+rrrk+q+
  Zjn_sc00034.1.g02820.1.am.mkhc 192 PRFHLLGEFDEIKRSCRKRLDGHNRRRRKPQP 223
                                     69***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-2364119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.7669146IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-2270120IPR004333Transcription factor, SBP-box
PfamPF031101.6E-1772119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114112.639140221IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-12190226IPR004333Transcription factor, SBP-box
PfamPF031101.8E-7193220IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MDWDTKMPSW DLGTVVGPSS GGGGALDLKL GGPTSWKSAA TAAAVPPPPP SSSSAPAKRP  60
RSGQAQQAVP ACSVEGCTVD LSKGREYHRR HKVCEAHSKT PVVVVAGQQQ RFCQQCSRYA  120
RAHARSLIAA NMHYSWIPFP SNAIIPFCFW TETLVTPPFA GWLLLRARAF WASPRQRNAA  180
DAVELDFGVE PPRFHLLGEF DEIKRSCRKR LDGHNRRRRK PQPDPLNPGV LFANHHGATR  240
FASYPQPFSA ASMADPKWPA TMVKTETDAF HDHYVPAVHL NYGASSLFNG KDWKHSPFLT  300
HHGDDAATAL GCQPFTITAS SESSSSKQNN GHRALSLLSD NQTPAQLMIP TAQPLGAALQ  360
YGDAARLPED GDVSFTGMTY VSAGGKQASV LATPACHPAV TASPGPATQL QYHGYGYHHV  420
SGDDQGDQDG AAIQALPFSS W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-1672119653squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203220KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971091.11e-109PREDICTED: squamosa promoter-binding-like protein 2
SwissprotQ0JGI15e-64SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLA0A096UG781e-136A0A096UG78_MAIZE; Uncharacterized protein
STRINGGRMZM5G878561_P011e-135(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-19SBP family protein